SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008897 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T008897
Domain Number - Region: 220-265
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000179
Family Centromere-binding 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008897
Sequence length 274
Comment protein Name="PYU1_T008897" Note="Protein of unknown function" AED:0.201818181818182 QI:0|0|0|0.5|1|1|2|0|274
Sequence
MAASNSSIAADARASAAASSPAGVDSAALTADKDAGGDGAATAATEIIRGESAAVPRGAS
NAPKASRASLSIHEKSIVKSYCEQKIDECKARGEVVPSQDVLRREVLAKFGWQMGRSTLS
KIMTMDWKALNVGAHRNPNMKRKRKPLFPDFEADLVQYISVHIAQHEALAAAATDDMIAA
GTTSSAGEIMAVSSSDGSKQHAMLLPNDIHALKMAALQPPKNRHVLTEAIILEEAQRLKQ
VHGIKDEQLVLSVGWLARFKHRNGIRLRKMSTEL
Download sequence
Identical sequences K3WV99
PYU1_T008897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]