SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008902 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008902
Domain Number 1 Region: 22-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000117
Family PARP-type zinc finger 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008902
Sequence length 116
Comment protein Name="PYU1_T008902" Note="Protein of unknown function" AED:0.253994797473058 QI:0|-1|0|1|-1|1|1|0|116
Sequence
MTMTLSSSPTTSTLSPWTKDHTYIIESTRRAHACCKSCEAKIELGRLRVGVVYQHMNGFV
CINWHHIECYPDVKQIPVHNLEGFGDLDAVHQKLVQSYMVAGVDTRYLPEARACSA
Download sequence
Identical sequences K3WVA4
PYU1_T008902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]