SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008923 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008923
Domain Number 1 Region: 25-111
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-25
Family Canonical RBD 0.0019
Further Details:      
 
Weak hits

Sequence:  PYU1_T008923
Domain Number - Region: 176-221
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0405
Family MW0975(SA0943)-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008923
Sequence length 289
Comment protein Name="PYU1_T008923" Note="Similar to Rbmx2: RNA-binding motif protein, X-linked 2 (Mus musculus)" AED:0.176737004632012 QI:0|0|0|1|1|1|2|0|289
Sequence
MNVIAEIHRINERELELGVPYEGSWHQKYKDSAWVYVGGLPFELSEGDVLCVLSQFGEIE
DLNLVRDAKTGKSKGFAFVKYEDQRSTVLAVDNMNGARILERIIRVDHVLKYKLPKEIQD
REDAKEQAALSSDDDAAKPKQRGLPGHAYEGKELDGKYDIAHGHNVFAAPQETKKERKKR
RKEEKKSKKQAKKVRKIEEKQAKLFAEIQQKRKAQREQELLQQQRQHDDDAGDAPVAEAS
ASGWRGRLEPNVPRANARRPDGRGGAGARDRNDGDSARDASYGGLKRTR
Download sequence
Identical sequences K3WVC5
PYU1_T008923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]