SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008929 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008929
Domain Number 1 Region: 15-47,78-169
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000997
Family Synaptotagmin-like (S variant) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008929
Sequence length 524
Comment protein Name="PYU1_T008929" Note="Similar to DSPP: Dentin sialophosphoprotein (Homo sapiens)" AED:0.296845646725509 QI:0|-1|0|1|-1|1|1|0|524
Sequence
MAPHSHPSTTFDADTKYRLFLRVHSARDLQHKSAQGAYCKLYVGDSAMLDGSQKKLLKKA
SSESNNNDDAHGHDDAVESVRVFRTHTKVADAGHETHWDETFEVSILDPTTEIMSVRIKS
QHRFYCPVIGTFAVYLRHLRVGEQADQWFPLHRGKKEAGKIRLHLLLTPEAAGGRAKKKR
NSSDLSADIKVALAANHEADKAIERLVQKQLKDEEERRLRKQRGEDVNVNQQNAAGALGK
QLDVVSITKVKEPSAPGTGQEARFFGASESPNNQTSSDQYARLKQVDAIAPVPKEGRRNG
DALGLGREGSRFAQPTSPSHGPSPTAFNARSTVPAEAERDSKRNENFARLKELDTTPVAS
EQQTSAYAKVLLGSGRGSSRNSLPSTPSSAARPTALYSIPSFGIDDLHRSKRHSSSSTDS
DSLAEYERRIDRKLRKVRKETEKLRKIRKQLKKYIPDLASSDSESESSTSSSGDEKRRSS
ASRHAMKDKQTRYSSDKSDVHAAVPVTKAVKPQQSKRSDERFYV
Download sequence
Identical sequences K3WVD1
PYU1_T008929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]