SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008932 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008932
Domain Number 1 Region: 106-289
Classification Level Classification E-value
Superfamily Macro domain-like 5.05e-48
Family Macro domain 0.0000773
Further Details:      
 
Domain Number 2 Region: 303-615
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.01e-20
Family Sir2 family of transcriptional regulators 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008932
Sequence length 964
Comment protein Name="PYU1_T008932" Note="Similar to M6_Spy0919: UPF0189 protein M6_Spy0919 (Streptococcus pyogenes serotype M6)" AED:0.0274252024362733 QI:0|0|0|1|1|1|2|0|964
Sequence
MSHSELAAKYETLVVSVAKSLLAERGYSQHHIEGEATGDVREIVQQLLIMRPPPDDNVAD
TEEALYAQIDELLELEQRRQVITDAHALPSVVDDTEAPANLVPWNQIALWKGDITTLNAT
AIVNAANSALLGCFQPTHKCIDNVIHCKAGPRLRAACHDIMSRQAKEEPVGQAKITPAFV
LPSKYVIHTVGPQLRRGQSPTAAQRAQLKSSYTSSLDLLLETVGRDTQASIAFPCISTGL
FAFPSDVAVPLVVNAVVEWLKDHPETSLWRVVFNTFLQHDYDLYKQYIESQHAGLSLPAP
TAVPALETASKLLEEADYLLITAGAGLSAAAGLDYTSEEVMKKFHPSLQKRGLRTMYHLV
GRTDFPLEFFWGYYFTQINNVRFNWTKHRTAPTYATLKSIQDCFERKVQWSTFVATSNAD
GMFGQEGFDLDSVYTMQGDYGYLQCKTPCSRESVFDMKPFIDRALPHVNPETYHIDSEEG
MPKCPNCGGDMYLSLLYGSRSLEKVRAKQRKVYQQWLSNVLEKVRTEDKKLVILEIGVGF
NTPGVLRLPDERMATINGVSLVRVNEAQADIPFDSNGLGVAVDANDALEFFQRKLIVAFL
VPRLRDSIPSVLRRLHAQCLLMHENQAVCLRAHTRLQRVWQELQFMPTARELAATLPVLA
IYGELLTRFERILARFAVDDAIFRLMLSRQFFVKMDQLHRGVSIVVQAQQQHYHHQIALT
IETNGRDALRLWKLQWDADRRVQQVLDQQRSGYAAKVSKEQNAIGNEVKQLCAMRDALEA
AAGAVDATSKPAAVAIFVSINGDEKLNQVVEISKWEIVALQSGEASRLGCCSTMKSTKVE
AACEVSRCAAQTTKLSDGAHKDYGAASHLQGCRLVRAHGACHLCIPVYFAFQDMESASET
LFDAFVSSHDEQLVRFFYQVELSLHLPHENQAFGDSEAQSVCKFGITEMTLRRNADNATT
EPKS
Download sequence
Identical sequences K3WVD4
PYU1_T008932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]