SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008942 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008942
Domain Number 1 Region: 147-434
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.69e-76
Family Sir2 family of transcriptional regulators 0.0000119
Further Details:      
 
Domain Number 2 Region: 85-133
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000329
Family PHD domain 0.059
Further Details:      
 
Domain Number 3 Region: 534-579
Classification Level Classification E-value
Superfamily RING/U-box 0.000000283
Family ZZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008942
Sequence length 587
Comment protein Name="PYU1_T008942" Note="Similar to sir-2.1: NAD-dependent deacetylase SIR2 homolog (Caenorhabditis briggsae)" AED:0.258733624454148 QI:0|0.25|0.2|0.6|1|1|5|68|587
Sequence
MSASRARLSRRAKLQDVDYAVLASGQQIPEYSSESSSDDDETYGGSSSRRRRTARKRKGN
SDTECVAVAPPNGSNKRKRKKLQATDQCFICEKESKSAFMQCEICARWYHYRCWKPFEAS
SVLGHTSCHECVQETPSNGLDAASPHPHQKIATLKDFVGVLKKAKKILVVAGAGMSVSCG
IPDFRSKDGIYAMVRHMDTHLPEPECLFQIEYFRQDPSPFYQLVRNVFAHSPLPSPTHRF
LKLLQDKKKLLRVYSQNIDGLEEAAGVTKYIPCHGSFAWSTCMKCKHRVATSTLMDVILA
GVIPTCGVEGCRGVLKPDITFFGELLSDHVSTSITKDRLQADLLLVIGTSLKVSPVAEIP
GFLPRHIPQVVINKTALKKKKLNKSSSTSGASKKLKKNGRGGEDDDKDEFDLTLLGNCDD
IVQHICELTHWDLPEARGTEAAFSNESSSDTRKKTGQRPKSPEVVAIDSDDNFEPQVVRK
AKHKKDKKIKKSAPSIDVIAHKDKPHVLCFGECHCTNQLDAQHYHEDDNSEPDGFVCDGC
GEDYGAKLTDMGHYRCDDCFDFDLCGACYRKHKHTHKQGQHRFTKVT
Download sequence
Identical sequences K3WVE4
PYU1_T008942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]