SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008973 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T008973
Domain Number - Region: 9-85
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0244
Family PH0223-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008973
Sequence length 118
Comment protein Name="PYU1_T008973" Note="Similar to ZIP9: Zinc transporter 9 (Arabidopsis thaliana)" AED:0.495683022549389 QI:0|0|0|1|0|0|2|0|118
Sequence
MVPNGSKTDVSSNKRKLSTILFEVGVLFHSVIIGIGLGVTTGTSFKTLLAAITLGTIESP
RNVLMMDFVFAVATPVGVVIDILIRSSYSSMSVTGLWVHSMLNCIAAESWCTRVSSSC
Download sequence
Identical sequences K3WVH5
PYU1_T008973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]