SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008999 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008999
Domain Number 1 Region: 249-374
Classification Level Classification E-value
Superfamily NTF2-like 9.11e-16
Family PhzA/PhzB-like 0.063
Further Details:      
 
Domain Number 2 Region: 31-73,138-194
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000135
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 396-541,570-584
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000637
Family PLC-like (P variant) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008999
Sequence length 712
Comment protein Name="PYU1_T008999" Note="Protein of unknown function" AED:0.0767937673212498 QI:0|0|0|1|0|0|2|0|712
Sequence
MAHAVGLSLTEEHMKLTQKADRQLMKLIPVAWEGIVKKKGEWLPRWEEVYVTLDGLALRV
FESKAKFLELLAIEERNSTKARYPAGSPPSSRGSITGANASQRTASMSAIATQKSLVVTA
STKKPEKVTAASTSSKESRKGCYTIKAVAKENVGRAHGFSVATLEKKPMHFAVESEIERV
VWIHLISAALEQQTILPKAKKRLTDQLPASTSGRLSVTIPHAPARGLVPGSTMMKTLLGT
PISVNLYMFYEAWGHIQCRKGNFADLIPSLHPNITITSNYPPSVPIAGEYYGCEGFLFFF
TKLHSSIDISHYTVQHMARSGDLAVVTGRETIKNLASSRKFRHLWKHELRFEADGRISHI
NIIADKTAAAVAFGVQSDGPSLELPHEQEESASTCPPGEIRVVCISGEGIKKKKPIPASA
NIKVTIGLNNFPHLTMKATTSGGSSKAVNHIGSWKSYSTRPSKNGNGTNPFWAETLSIQF
SGAVPGTSSCLFIEAWSLSVMGDELIGCTKVNLANYLGTSAGTEEDIASLAVPKWYELRK
PEEFVPSSGISGSPDKKKVASSGASGSGDSQDNCGRLQLSISFLPHTDDDDTFFNDGTEA
TPPRHRKSFDRLQALHEETGEKERNTLDPEAESTADSAFDFSFEKENRSKLDKDTLRRLI
FEDVCHFHPDAQDELDRFVREQERLRTVEERTRQREESSSSSAPSSQRAGMA
Download sequence
Identical sequences K3WVK1
PYU1_T008999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]