SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009017 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009017
Domain Number 1 Region: 66-162
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.000000361
Family Lambda integrase-like, catalytic core 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009017
Sequence length 163
Comment protein Name="PYU1_T009017" Note="Protein of unknown function" AED:0.187558630393996 QI:0|0|0|1|0|0|2|0|163
Sequence
MVTARYSPVFWPRRMLLFTIYRCLSCRDPRTRYLECNGAIASYAITKSDVTFKDGNGHVT
TTKKTIDAAVIRFRGGKSDQFGQGSVRRLRRSGHATLCPVKATWSLWHRDLAPDALLCTL
PSGKCLSARSMTAAIKGGASSIGLNPSKFGTHSLRSGGATAMF
Download sequence
Identical sequences K3WVL9
PYU1_T009017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]