SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009047 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009047
Domain Number 1 Region: 78-189
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000115
Family Ubiquitin-related 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009047
Sequence length 633
Comment protein Name="PYU1_T009047" Note="Similar to SPAPB15E9.01c: Uncharacterized serine/threonine-rich protein PB15E9.01c (Schizosaccharomyces pombe)" AED:0.0443014047763899 QI:0|0|0|0.66|0.5|0|3|0|633
Sequence
MTDREQQRVTAEGIASAAPREYEPANVGRATAEAQATPMVAAEGTSQSAASAGKVDEEET
KMAAAANNAPTQIDGNDEEKMVVVHLKFIGDRERVSVRCSPTIVIADLKQKVLAAHAQLE
QQQQQSDSTAAEDANREQESVSIATLRLIYKGKVMKDDHTLALYNFVHEDTIHAVFGRPQ
ASSPSQNSGVAHGDASTATGPTAMSPATATRTSSGGVATTSVQDYGNGLRVGQISIDTDA
DSPLPDLGNLINSMLSSLGGSSGSLPDGATASIRIFSDPSALGPLSSDATTNSASSNLSS
TSSTTVSAATTSTSTTAGPVRPTVATAPPAVTTPSTVATTDATSLLNQAASLRRLLPAME
LAPLSRPPELSLEMYNLGNALREAGDTYLAVHRQLQFVVTRFLSENNLNESERLRLRTRV
HQLVPILEHIASMSRAVARNLDSSSYYGPGSQTPTTSGVSEAPAASSVSTPTAPSPAATT
ASAPPPSDPSVNVSPTVNIFGGGNGHAGGIAGIGSSIAEILQAVNNFRPGNMPPSGAPTT
AATSDGTTTSTAQDNSAGGLGGLLNLVSTLTGARPVQPAAPRPSTSVSSAPATSSQPSAN
FNQPLSDLFAQVMHDMDTLDEWDPEVTEQLLKR
Download sequence
Identical sequences K3WVP9
PYU1_T009047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]