SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009074 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009074
Domain Number - Region: 10-57
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0654
Family SIAH, seven in absentia homolog 0.022
Further Details:      
 
Domain Number - Region: 84-220
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0942
Family Phase 1 flagellin 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009074
Sequence length 341
Comment protein Name="PYU1_T009074" Note="Similar to Hr4: Hormone receptor 4 (Drosophila melanogaster)" AED:0.0996947024423804 QI:0|-1|0|1|-1|1|1|0|341
Sequence
MGGNKHKNGIVCMYPGCEKTMRTQKFKLHFTKQHLKPGEVYTVEHRRRFEVARDEEYVSD
TSSPHPLEQHLPIAVQIPTSYQVQQVQATAATVATTTTAATNAVANAATTAGNAQVVTPS
GGSENAATAVVTTTATANEEASTPAVTSTTIDNTDANATAIADAVTPQRLPRANPNQPRS
SDGRFGYTNASHKRPVSAIEPTPAAVAAMTTARTEVNTTATQGNGQQQVGDLSRAVLVEY
IEMMDQRFHELIQKMGQVIDGQRELIDMLRRPFPAETAQLLEQTPSLATSAAASQPSSQS
SSPPENLAPTADSSAKKRRKSNSSADLQAQQQPNGGTMSLL
Download sequence
Identical sequences K3WVS6
PYU1_T009074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]