SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009079 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009079
Domain Number 1 Region: 16-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000217
Family Recombinase DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009079
Sequence length 234
Comment protein Name="PYU1_T009079" Note="Similar to tc3a: Transposable element Tc3 transposase (Caenorhabditis elegans)" AED:0.251585623678647 QI:0|-1|0|1|-1|1|1|0|234
Sequence
MATPPAAAGVRRGKRKPSLSYEEREQILEMRDANASAREISSVVGRARSTIHTFLKDPEN
YGKGRKRSGRRLTLDDATQRFIIKEAVKGEKTTAQIADDAPMKVSARTVQRFLKKYSELR
QGRALPLPSTSTTTDGASSSSGSEGDGDEREENAEEARIEAIAHEQQVIRPHAEARRIAD
GGELEPTRREFMEQINRRFEDMTQQIKRLADGQNALIELLVRAQQQRSNGHEPA
Download sequence
Identical sequences K3WVT1
PYU1_T009079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]