SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009094 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009094
Domain Number 1 Region: 258-337
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.48e-16
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009094
Sequence length 342
Comment protein Name="PYU1_T009094" Note="Similar to Pabp2: Polyadenylate-binding protein 2 (Drosophila melanogaster)" AED:0.0537508561351763 QI:0|0|0.33|1|1|1|3|0|342
Sequence
MSGFERILARVGGDALRDYCSSAIEDELKNLKEKMYVCLTSVEKALEVQDAILKLDVPLT
DNAATFAAIQSGYQKFNDDLDKFIKEQKKVQAADVARKAEDEQSHSGSTKRRRTDSVASA
NGQKDSPQGQEITRLLGKIQHRLTRKKNDTWIAKNINDVGTIASLVKLKVPEKAQRKDLV
LVLDHFVSAVLLSAFVTDSVLAQLSNMLVNLVGAHDDIDDYIRLNSAIVSDEPQPKKTKI
EHNAVDLIMKVENAATSNQPPGIFEVHVYDLPWGAKQTDVEAYFSGAGTIASIRMPTMDD
GSTVGVAIIRFATYESMSTALRMDGYHFQGKSIRVTMPAKST
Download sequence
Identical sequences K3WVU6
PYU1_T009094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]