SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009099 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009099
Domain Number 1 Region: 93-160
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000116
Family Centromere-binding 0.0054
Further Details:      
 
Domain Number 2 Region: 22-67
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000358
Family Cgl2762-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009099
Sequence length 199
Comment protein Name="PYU1_T009099" Note="Similar to Pogk: Pogo transposable element with KRAB domain (Mus musculus)" AED:0.1325 QI:0|0|0|0.5|1|1|2|0|199
Sequence
MAAALGNNHDAATASTAPKKQRNQYNLEFKLEVASQYEPNVHGRGFEALARQYGISKSNV
MDWVSKKPQMLASLAAKGGHAARQAFRLDGCGRKSAYTALEDKLGKWVLEQNAQGVRVKD
KDIKDRAMLIFREMHPEMRADDENAFKASSGWLARFKIRKNLVVRRPNKVGGDDDEEENI
PVAGETNAKRFHGNDSDSP
Download sequence
Identical sequences K3WVV1
PYU1_T009099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]