SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009127 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009127
Domain Number 1 Region: 96-227
Classification Level Classification E-value
Superfamily Lipocalins 0.000000000301
Family Fatty acid binding protein-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009127
Sequence length 254
Comment protein Name="PYU1_T009127" Note="Similar to gcdC: Glutaconyl-CoA decarboxylase subunit gamma (Acidaminococcus fermentans)" AED:0.128279883381924 QI:0|0|0|1|1|1|2|0|254
Sequence
MNINTNSNLHAANATSVVGNSIAIPPRVAAPSVNPTPVATAAAAAAAQMSLNHVRSAFKP
AVPTAVPTPNPAAAAAVVAAAVPSVPNTAGAGALHLSGRWSLDRDDSDSTNDYLEAMGLP
LIARQAADKLDLMVIINQSPGEFVITRRTRIFTETKTLKFGQEVNVKGNLIKVTGEPTQI
KTITQLSGYRGILTDIRTIDEKGRMHVELTLTLPDKPSVIIHRYFKKTSESTSLENLPAF
DMSLENSSDVKRKR
Download sequence
Identical sequences K3WVX9
PYU1_T009127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]