SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009176 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009176
Domain Number 1 Region: 35-408
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-109
Family Motor proteins 0.00000194
Further Details:      
 
Weak hits

Sequence:  PYU1_T009176
Domain Number - Region: 593-653
Classification Level Classification E-value
Superfamily ATP synthase D chain-like 0.0458
Family ATP synthase D chain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009176
Sequence length 834
Comment protein Name="PYU1_T009176" Note="Similar to KIF6: Kinesin-like protein KIF6 (Homo sapiens)" AED:0.0162073443474496 QI:0|0.66|0.25|0.75|0.66|0.75|4|0|834
Sequence
MMKDDAKSVSQYGDDDDNDAASQDAADEQPEADSNIRIFLRIKPSKKPSGFFSWDEDASE
MKYNIPKDVAAGLINNSRTSYKFRFDSVIGMDAKQTEVFDRVGRPCIENALNGFNSTVFA
YGQTGSGKTFTITGGAERYEDRGLIPRALSIVFDEAKKSPQRQILVHISYLEVYNNQGYD
LLDPNHESTKTLEDLPRVTMLEDEDGNCHLRNLSMHLVHSEEDALNLLFLGDTNRAVSET
AMNATSSRSHCIFTVSLESRRAGSEVILRSKLHMVDLAGSERAHKTGAKGQVLREATYIN
TSLHYLEMVIVALHEKNTKGRAHIPYRNSMLTSVLRDSLGGNCKTVMVATVSPEKDQTDE
SVSTCRFAQRVARVRNDARLNEEVDPAVIIRQLKARVATLEEEIAVLKGDVKEGAELKDY
EVDKLRQRCIEYVNDMEPTAHLSMGEFTYTRMKMCFEILKSMANTALSSATSAAAGSGSE
NKSASVRKPSGFAVASGNNNNQELENRILELEQLVQQRDNEIAIMVNMIRNSKAAGGGGA
SIPENLLARQMGPLNTKDFGDNQTEAQKAQQKAHGAKTQLPVDTSFTATFRVDPAILDDP
TKSFEAFKAHYPKNDAIRENKILLKQKYDAAKELANVVNDARNQIKHLTLQIEKLRKQQA
ITDEGLLDSSSSNTAGGGPNNATSTSSSANDDASAAENKLKDKIEQHKLTYKKGFHELNE
LKKEIQHIQKMLEMSRIKLQKDFDLWYQRQGKGALLTEALVAQPKSDANNSSSAPPAAPV
RSASPARPEMQAKTSLSEKKSAWEPTQSMTSSTEIKKLVSTPRSSSRSSSTAFG
Download sequence
Identical sequences K3WW28
PYU1_T009176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]