SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009182 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009182
Domain Number 1 Region: 15-211,278-344
Classification Level Classification E-value
Superfamily DNase I-like 7.8e-30
Family Sphingomyelin phosphodiesterase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009182
Sequence length 422
Comment protein Name="PYU1_T009182" Note="Similar to sph: Sphingomyelinase C (Leptospira interrogans)" AED:0.0558591885663136 QI:0|0.83|0.57|0.85|1|1|7|0|422
Sequence
MVMPLVNGEYNGIDAMAFEILQYNVFGRPYEVSKDGQAERLARIPASLRKLSEHIDIVTF
AEADVKGERESMLTQFRDIGFQYATSILHDPDPFTSLLNGGVIVVSRWPILHEAQHIYRN
ACHYSDCLAAKGVKYARVLKTVGGTSKIFNVFATHMQMRKFVDDMRIPTHEPLLFAGDFN
VDNHTFASEVAELIELLGAHSPTQVGDQQFTSDPRSNLLVGRDGAANSNKCSEKYMQSWG
DVKDGVYYPNALTRSTCDLHQHLPHELLIFIQPDNMCFCSCCPLEWLDYVLYAKAPYQQP
LDGSTLESRINHVDPFVVDWTAPKSNMKMQLVDLSDHYPVLGKFVFAVNHGPGKDDDPLT
YHLDGCSTDADCHFRAFRCYCNGANCYYNGTHLDGSDLASTHPVNRNCLYQKTSFQCLCG
PT
Download sequence
Identical sequences K3WW34
PYU1_T009182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]