SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009190 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009190
Domain Number 1 Region: 594-683
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000203
Family PLC-like (P variant) 0.034
Further Details:      
 
Domain Number 2 Region: 746-896
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000234
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009190
Sequence length 939
Comment protein Name="PYU1_T009190" Note="Similar to vps13A: Putative vacuolar protein sorting-associated protein 13A (Dictyostelium discoideum)" AED:0.636095961247779 QI:0|0|0|1|1|1|3|0|939
Sequence
MYSPARQKSIICQASVQVIDMYVYVILADVSSAPPYRIENYTPFTIDCAQLGESSLFKGA
EKEINITIKPGEWHSFAWYNPLSKDRNIEIKVSHRDAPKAKTKNYDIDYVGYQDPISIEI
APDGEKSSDKKQFEIVVEVVVDESTRVLKFMEKELEMNRLESQEAQFENDFQQRKMLYAS
SFDIRLAGFGFSLLDGYPQEVFFASLDVLQLQKVPSSLEWVFSIFNLQLDDMLTTAKFPV
ILNPVDAGYSDKAVGKDPKPLLKLVLDADLAAKVGTYKLLDFDLSNVSFKVDIDYLVNLV
KLVEPYLVSDATVAHRSARTLEQTLERCVPPVPVIQLTADGNIQHDLVYFDILRIHAITI
DLEYSITRNDIVSSTSGAGRQVIGLVGSNLSGSPTLSFNEIVISRCFTTKQRLQNQLIQN
YIRQGVLQAYRLVGSADIIGNPIGLVEDLGSGVIQFLKITKGEVLGDSQTRGEGEFADEE
EPDSPDAKDNDNGVVKFGKDLGKGLTGIFTKPVKGAMKGGVTGLVSGTVSGIAGPGVVLL
KRLTSTSHNLALGVESSVVDRSPFGGRRRLPKRIINGKLIAEFDESHYKPTRMLLEVIGA
NGLLSDDSCDPLTVVRIDDKVILKTRVLYNTLNPVWQEKTQVELSGSESEVQLVVKDSYG
GAIDKTIGKCILPMQQLQDDFKPPEHSSDLAEWVKTGVKPDDTKKNVSHQIKEREYELLM
PKTKRSASALLSIGGSTNKLRDANNDYQVLVTILSLEDLKVSSSSGGGVLGLGNLVSSTP
NISPYISIHVGKNVSRTTTAKMTFMNGDKKQQIGSAEWNEAFTFPYSTKDFESSPNVTFS
LKDYSMIHDERLGRAFKTLDPSIANANVVAVNKLKLTEKGDDTGDVVGYLNVKIEVVSSS
ASSPPTTPGTDGEPSTPRGAVGASDTLKAGKIRIACEFV
Download sequence
Identical sequences K3WW42
PYU1_T009190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]