SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009212 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009212
Domain Number 1 Region: 129-324
Classification Level Classification E-value
Superfamily SET domain 2.75e-57
Family Histone lysine methyltransferases 0.0015
Further Details:      
 
Domain Number 2 Region: 1207-1427
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.05e-27
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 
Domain Number 3 Region: 656-795
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000000284
Family Cyclin 0.0019
Further Details:      
 
Domain Number 4 Region: 504-607
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000168
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009212
Sequence length 1559
Comment protein Name="PYU1_T009212" Note="Similar to SETD2: Histone-lysine N-methyltransferase SETD2 (Homo sapiens)" AED:0.0188742748328241 QI:0|0|0|1|1|1|6|0|1559
Sequence
MSKSVRDDGDGVTKENKAVETVTHQIENVHTKHVVDEEKSVGEGKATAVDVHDEPARETT
TAAVAVVEEKAVVERAVVTKEKDSAGDRKSFRFEHLEAIRNVHLITRNEYPLPHLPREKI
LHRDYDEDDDDEDSTVCYCSYPDALDKDKKRCEDVSCLNFATYVECNSNCPAREYCGNQR
LQHKELFPILEAFKTENKGFGVRTTQDIAQSSIIGEYVGEIIDQKELNNRLKSVPRNELN
FYYLLLEPGIYIDARNKGSFTRFVNHSCEPNCKTEKWTVKGETRIAVIALRDINEGEELT
FDYQWKSLGSRQIKCFCESANCKGIIGTEGDTVKDDTPNGYFREPTKQEIGAAIINRRIR
IFKSPDDHTQYYIATVKSYDKEDDIYEVDYQDMLYVAEEDEDGDLFDDSPEERNSERFIR
LSEMGWHIFFELDGLSEDQIEKEVFSIPKRRLAESREPSPKATEHDGHSTRSSREPSPIT
TASATNGKVQQSSSVVDKREGDAQAEATTNKILVKGIPAKCSESTLRQLFILDDRFYRMG
HSDSRKKQQPQSALAALDFFFFDDDSGWALAEFTDPQHTSYFHRNLNSRPLYGKDLRVFL
AGKKEIENFYRAKRNFALRRGQEKKADPKPQSSLEEKETSAPKKVIQPYCFGRKLNWQVS
VEQMEDSPSRRYGISPSLEQSLRTKCVKFILRLVKKLHFERDDATSAIIALNRYFTFHAM
DVRTEEMMAAAMLHLFVKAHSRNYKRVSFVSEVYAAKSLAEETKQLDKTSDEFLATERQL
LAVEKHLLEGLRYDISGEDPYALLDALTSGKYRKKLPVDGGKLSSSSGQLPPSEVQKEAK
HLISDTLRLPIWVQMPVECVVLSIFYLSAAVTQVLKEVANPSSPTTPSVPEYLPVLDGQR
NELETLMLLDCSLSICESLKDRWARLEKNAKPSRKSDRSEDYFDTEEFALSREKQVEISQ
RISNLIKSWINVPSSSSVPGSSASPVKDDSRAAGKDECITLSMIGKSLMSSSTSGSEATR
DDLEVAISAGLVVPKVVAKGPRGGSSSVLSSTDRLHSTEITNVDKIRKRSYLGVVSEDVA
FDLAGKKVYLQPWPYRDNESPFSAQGEISKSCVRELSTAIMLHNYSPIQFIKLLGIVFPE
EKTAQSTQEQSNGSRTRIADLDADMMDFSDMNGQMRFSSSSSSQLESSEHYFAFEQPLHM
YSGIFEAKVTVPIELKKKAIYDMLRGLVVCHENSFVHRFVAPSHLFLFKNEVKLGGYHAM
RKVSSTKTKDGSSNVYEMSEDERKEHSMGPWLNVSAPEILLGDCNYSWRCDIWSAGCVAF
AILLDNTPFLQGNETRVQLDLIFRLCGTPKIVWDGATKLPLFSRYKPKNEYKMRLQKTLV
EQQKQKHPDLPEEAIALLEAMLQLDPSKRMSAKRLLELEFFADVRNAPASAFDFSGLPET
YSTQKKKLQQHLKSNKLKRKRPSNSGERNSSSSHRSSGSSSSHHHRSSERGGRDASSRKN
REPDAEMAEDVPLPAFFSPASEPKSLEESASSVSSSLQHRPEKRAKLGWGMGLHSESTA
Download sequence
Identical sequences K3WW64
PYU1_T009212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]