SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009230 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009230
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.63e-32
Family Canonical RBD 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009230
Sequence length 403
Comment protein Name="PYU1_T009230" Note="Similar to Cstf2: Cleavage stimulation factor 64 kDa subunit (Mus musculus)" AED:0.0281387513751374 QI:0|0|0|0.25|1|1|4|0|403
Sequence
MNAANKARTSTAKERSVFVGNIPYDVTEDMLKEIFSEAGSVINFRLVTDRETGKPKGYGF
CEYADGATALSAMRNLNGYEINGRNLRVDFADGGDKSNSNSNNNNGGHHSHEKHTTSVSG
EVIIHAIENAISRFGPLKLYDMLVDLKEHARQRPDYTKSILTANPALTHAIVQSFKTLNI
PIPSPSEAQPALLSAPSHLHAPPPLLGRPLAPPPQRSPLNGAPGGGGILGMAPPGPPPMP
MAPPPAAPTKSGGTRWSARPGPLAGLMQVPSPAIPMQSAPVPAYQVPPPPVMAMAPPTSG
PPPPMQAQPPVNRDPRRARDPRLAKRPLAPEPQADPKRPRPDEHQYHQQPPASAAPPNQG
NGTFDAIAELARDMTPQKLNMLPPNERHILMTYMQQHGIPYSS
Download sequence
Identical sequences K3WW82
PYU1_T009230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]