SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009244 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009244
Domain Number 1 Region: 48-162,289-391,788-906,971-1079
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.71e-113
Family Calcium ATPase, transmembrane domain M 0.00022
Further Details:      
 
Domain Number 2 Region: 395-415,575-840
Classification Level Classification E-value
Superfamily HAD-like 9.06e-54
Family Meta-cation ATPase, catalytic domain P 0.0001
Further Details:      
 
Domain Number 3 Region: 404-630
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.27e-44
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0017
Further Details:      
 
Domain Number 4 Region: 161-270
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.1e-26
Family Calcium ATPase, transduction domain A 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009244
Sequence length 1148
Comment protein Name="PYU1_T009244" Note="Similar to pacL: Probable calcium-transporting ATPase (Synechococcus elongatus (strain PCC 7942))" AED:0.0831157528285466 QI:0|-1|0|1|-1|1|1|0|1148
Sequence
MLNDAQREELEKEAHRARFLSDAERVIVADPLKARESFMEIETKPDEREWHERSVASIMR
HFGVSDANEGLSSSEAQKRLALHGPNSLEPEKKTPVYIIFLLQFMNLIIGLLMAAALASI
ALQEFVEGLAIIAIVTLNAVIATVQEMSASNALDALQKMTSPQCVVIRDERQLIIPSAEL
VVGDIVVLTTGDIVPADIRLVFSSDFKVNEMILTGESEDVLKRYNADMSKSQKLTADNMV
FASTSVATGNATGIVIATGMGTRVGSIAALLKGNGPADKPKNFVRKFIDKYYPKMTPLQE
ALHRLGVFMGTAVIGVCVVVFIVGMVRENRDSKNPDRPLWLNMVMVAVSLAVSAVPEGLP
MVVTICLSTGTADMAKKNVLVRKLAAVESLGASSVICTDKTGTLTEGKMTAVKMWGDSVQ
YEITGGGFNPSGDILRNGISQTKSNVQVRSTLLSAVLCSNTSLQREEGEDGQVVWTPMGN
SSEAPLVVAAAKAGIWREEAMETFPRIAEIPFSSSRKMMITVNELPHGSNFETLVLPLDT
QYVANVKGAPNYIVKNCTQFIRADGTIVMMHPNDRHNVLEAVDALSSQALRVLAVAIRPM
AKLPYSDLEEDIEVKFEALCQPLIFVGLVASIDPPRQGVKDAIHKARAASIRTVMITGDY
LKTAVAIAKNIDLITIGADADQEAVDCNVLRPRQGIYLAEPDLDEITSRCSVFARAKPED
KIEIVKSLQRQGHVSAMTGDGVNDAPALKEADIGVAMGLAGTAVAKGASDMVLTDDNFCS
IVEAVEKGREIYANIQRFVCFLLSTNFGEITVIFTAIAIGTPVPLEPLQILVLNLFADGM
AAVALSLEKGDGTVMQERPRPRKQQIIYGRLWVLVLFNAFLIASGALIVFVFGLTWNFNK
VFTDDIYGHVAKVDGIPRFSDVVCQRWQGMGNGFLDITNCGALLPDGVTYRFNETIRNEM
YYEDENLLCFGGDFECVSEGISRAQTMAFVYITTMELLRAYTARSFTKSVFHDMFTNKWM
QYAALGSIVLTVSVTKIPVVMDDLFGFATIEWYEWLFAMVFSFLMVVFGETLKYCYRRRD
RKATYLRQAQDGYAEMMLEIRNLRHHVERLEGKFDVDMEYLRSAADNSSHGRSSTSSSDD
SHGKPSPF
Download sequence
Identical sequences K3WW96
PYU1_T009244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]