SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009260 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009260
Domain Number 1 Region: 129-311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-16
Family Trypanosoma sialidase, C-terminal domain 0.052
Further Details:      
 
Weak hits

Sequence:  PYU1_T009260
Domain Number - Region: 5-61
Classification Level Classification E-value
Superfamily F-box domain 0.0288
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009260
Sequence length 338
Comment protein Name="PYU1_T009260" Note="Protein of unknown function" AED:0.0830861273837716 QI:0|-1|0|1|-1|1|1|0|338
Sequence
MTAAADPPPPVSLDAIAPDSLRIVASFLSARELLQLSHATSFMLAFFEQDEFWGACEPKR
HFVASTSCKKDANESSEKASLECPPEKRPNSAKQDFWRHRALHFGGNRKSDDPGTVRKPH
HGYPFKNAVFQRATAFSFEFWFVVHSAEKHSERRRGGVLFGAQSKPFTVDAPSFFHQQFV
LIDPNLKLYCSVRKSQDKRLLTTLRADQWYHLVVVSSHEYETVYLDGYEMLTVRAPLPSF
FWTQYQHCQVGTGLVRHKWMGPASHVGWYNLNGVVDTFRIYDQALAKETVRELAHSGGLI
PSLKPVYSMRKELFALNTLAEQRFVRCTRPGEGHFEQL
Download sequence
Identical sequences K3WWB2
PYU1_T009260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]