SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009287 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009287
Domain Number 1 Region: 451-501,542-587
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000714
Family Synaptotagmin-like (S variant) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009287
Sequence length 1329
Comment protein Name="PYU1_T009287" Note="Similar to Inpp4a: Type I inositol-3,4-bisphosphate 4-phosphatase (Rattus norvegicus)" AED:0.13859649122807 QI:0|-1|0|1|-1|1|1|0|1329
Sequence
MAHRSAPPTSPNLMEFDDDSPRVHAPSVTAPASTGGASATSYFSDLRIHEPVVVPPAEQA
PLPSASSASPVDAHATAVDGPEPERLKLHFFVACTGVEGHLVASSARTAQTFMRGALNMF
AQTSLKTKSPRSKPATEVNVEVRVSREIPTGPSGAISSSSDNDNGDGSAPSMPSESSSNA
LSSESYWSERRKSRNPHFSVGFNIRCQSPAHFDRHVQIMVMIPDDSSSTNKNSAVFGYAQ
TSFQEMYTIATSGKFQQKMTLPVHSSVVDGATVVIRFADIHAQQHPLFHTQNNAFRSYLF
YPLMREEQEQMQAAAAKLAIEEAAEVDFSVKIPLQLMTVCHFELKQMYEEWKARYNYNRK
KNRHFDDDAEALNFGHDVYRVQVISGRNLTTGTSSSSDSLATSASRPSAFSIVAGRGGIM
NRLKTQAGKWPGTGGTSGAAGESANAKSEFSSGGSINPFVTVKYSDGASGPHEFLVGKTN
TEYDTSDPVWSLNKSATAKCPHGKPNTKMFVSAALPSRIDVSPVNSLKQFLFYRPSILQN
KDHELTGWLRFEVYNESYTYMTGVENEIIGEILVPLQSVRDSMTVEQQIVADAGADEDEA
GASSRQIVTSLTLVDWFDVRSPTSDEIFGQIQLRLNILLANPVESFESAESGNADNVAAS
TLVPGQPRTQRLASDCAPPMTTHPLENEMPLNFLYPHVVALQRHIAGVNDMIRLSESLLA
QRKTFKSSQDKKRADVQSIPTNLHVSYFRIYRNFASLAGPSSSTAAGQPRLDEQASTEDL
LGLGFSNVAKPNSPVPSATPLQASSQQRAVLPETHATITCGAPTAHAMGLSEYGLREMEL
EIHRLQGILDRCTPRIMTSNVRDNNSFLAEDITDYVFSSVPEELDDSEDDQLNETESTAG
NSSDPDSSSPQNEVAKPAAPKKYNSMAARAVAGAKAAKKRLPATKKPPKPKDMQGTEDGT
MVADAKYPPLRTEAEDGIDPTTSINYAVRVLCRLEMLRTEYYLRKSVAVSQSVSGLVTCF
VTELDLCLQEKNIKVLEQMAKVGFLIGWESLISSHGKELRMLSDAWVAIKCLETFAFQLF
ESNLTDVVLEKREHIGYTICVPVPSAEFALLPESLRQGELITVTSVLFTQGINEMQSLAN
MVGHSGVSIQSKINSTSLRSIVEYYNRFTACGVATSETSVGSHPDEILRNLRVSVETESS
SSKNTCILLHASDAVRSLHGGRVTYCKSGKDRTAMSATLEQARLVVQRKRHVLEEIEMGG
ATEYGPLEEVKNVANIMREFGVRMEIAKKNVGRYKYSFNSIQRKLLPEIYRPPMCTIQDI
VTSVTARDS
Download sequence
Identical sequences K3WWD9
PYU1_T009287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]