SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009301 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009301
Domain Number 1 Region: 59-147
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000484
Family Ubiquitin-related 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009301
Sequence length 171
Comment protein Name="PYU1_T009301" Note="Similar to V-UBI: Ubiquitin-like protein (Autographa californica nuclear polyhedrosis virus)" AED:1 QI:0|0|0|0|1|1|2|0|171
Sequence
MDAFAAPAGPVIESHAFAAPPHEETSDISVPDAEILSAEVDAMPDAAIESTIHGSDSSSS
GAATMAAEVSDLLRLRLKMLDERVVEVEAEASTTVAEFRIQVAHATQVPVYRQRLIYRGR
SYDPSCGETHRVGCGCVVIFQYDRRNGVHVDFHRRRLKNAMEQIAVSLRQQ
Download sequence
Identical sequences K3WWF3
PYU1_T009301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]