SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009337 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009337
Domain Number 1 Region: 271-390
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-17
Family UBX domain 0.0062
Further Details:      
 
Domain Number 2 Region: 461-505
Classification Level Classification E-value
Superfamily UBA-like 0.000000714
Family UBA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009337
Sequence length 521
Comment protein Name="PYU1_T009337" Note="Similar to ufd1: Ubiquitin fusion degradation protein 1 (Schizosaccharomyces pombe)" AED:0.00277606415792719 QI:0|1|0.5|1|1|1|2|46|521
Sequence
MEMDLNTRGAKWKKEEQKRRDAAKRKLQTEQLKRAAADKVQREMERVQAQKRQERLAEQA
QLEELALEEQRVTGGIKYLQRLRPVPAVTDGDKITLPVSALEELNPQNAHELGVFTFELL
YEDPLTQTTRKTHAGVLEFVAEEGTVGLPPKVAASLFRNLGGSSNSVGQVPEAIQVKYIR
LEKGKFASLQPRGVGFGEREIDFKKILERSLKAHTTLTVGDVLFVRHGKETFEVLVAELQ
PEAAVNILNTDLEVALLPSEAITNAKEIKRKREEALAAAAARAAELANEKERRKAEKLTA
LVLEPPAEERLQVKIALRLPGGAQNIRYFLHASPLGHIFDFVEALTGEPATCFQLAATFP
RRIFGVDAKEKTLKELGLNGRQEALFVEKISDPAAVLIEEGDQAMETQDAGLELSSRTHL
PDQWEEARQQLEKSLDEMLNANTSTPIHAIEPIMPVAQSSNHETKWEAQLAELEAMGFLN
RALNIEILERYQGRLLRVVNYLSEMPVESAGTGEGVTAMED
Download sequence
Identical sequences K3WWI9
PYU1_T009337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]