SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009342 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009342
Domain Number 1 Region: 1766-1978
Classification Level Classification E-value
Superfamily TPR-like 3.31e-29
Family HAT/Suf repeat 0.027
Further Details:      
 
Domain Number 2 Region: 1478-1575
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.27e-16
Family Cold shock DNA-binding domain-like 0.0028
Further Details:      
 
Domain Number 3 Region: 503-602
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000821
Family Cold shock DNA-binding domain-like 0.029
Further Details:      
 
Domain Number 4 Region: 604-685
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000103
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Domain Number 5 Region: 1233-1325
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000373
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 
Domain Number 6 Region: 1408-1487
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000194
Family Cold shock DNA-binding domain-like 0.0075
Further Details:      
 
Domain Number 7 Region: 212-304
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000522
Family Cold shock DNA-binding domain-like 0.0046
Further Details:      
 
Domain Number 8 Region: 101-143,180-223
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000105
Family Cold shock DNA-binding domain-like 0.026
Further Details:      
 
Domain Number 9 Region: 304-395
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000111
Family Cold shock DNA-binding domain-like 0.028
Further Details:      
 
Domain Number 10 Region: 795-879
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000114
Family Cold shock DNA-binding domain-like 0.017
Further Details:      
 
Domain Number 11 Region: 455-502
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000147
Family Cold shock DNA-binding domain-like 0.0082
Further Details:      
 
Weak hits

Sequence:  PYU1_T009342
Domain Number - Region: 1711-1761
Classification Level Classification E-value
Superfamily TPR-like 0.000759
Family HAT/Suf repeat 0.041
Further Details:      
 
Domain Number - Region: 1316-1397
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0647
Family Cold shock DNA-binding domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009342
Sequence length 1987
Comment protein Name="PYU1_T009342" Note="Similar to PDCD11: Protein RRP5 homolog (Homo sapiens)" AED:0.0242934882019389 QI:0|-1|0|1|-1|1|1|0|1987
Sequence
MVATQSFPRGKKQPPAAAAAAAAPAKSAKKRKHDDAGAALEVDEDQDTGADALFGKKGVA
AKSADASAAAAAVKKTKKVVKKPKVDADKDLKEPKEATATAITFKSLRKGALLLGCVRQI
NDGELLISLPNKLNGIVTAAECSDEFFAYYEKQQDKKQKKRPGIAVPGASFGATKDAEEE
EEPAVLSSIFQVGQFVPCVVLSASKESKGKQIYLSLRTSLLHAELLPQTVNKGMTLHGTV
ASVEDHGAIINLGVRGLNAFVPLKELKTSEITPVKGQHMFVNVLSMNSHTSTATVTPDRS
QVVKAVTRGDSFTVKQLVPGMLLNVRVEEVLKNGLSVNFLTFFNATVEQNHMSNPCHLGW
EESYKKGLKGRARIISIDFVSKQITLSMAPHVVHLAVTEPSFTIGDIINEATIERIDEGI
GMLLSLQKASANGSDMDVDEEADAPTKATWKTFTPAYVHISNVSDNRVDKLEKKFTVGTK
IPARVIGFAPFDGLVNVSCKESSLSQTVLRHADLVAGEKLTGTIIKIEPWGILLELSEGV
RGVVSPQHVPPFVSLKKTGKKGDSSGKYQVGKKVEARVLRVDMESKKTYLTMKKTLLTSE
IPVLASYEDATMGRVAQGYITKIAEYGVVVSFYNGVYGLVPAALLHQAGVVNLEEAYVLG
QVVKAVVTRCDVGKKRLMLTFNAAASSSVKASSGASSQEKSELIGKTVKNVKVLDVEATC
LRVQTEDGLEGVLPFVQLTDFPRQTALVDELVKQYEAGDVIQEPLLVVSESKDSVLTFSK
KPLLMQYAGKSAVLPSSFSDIKEHAVLLGFVASVNAAKGVFIKFLNNLTALAPKAFLSDK
FMADIEDGLFEMGETVLCHVEKIEKDKQQFVVGFRRHQELLAGVKDMSSFFQSYLREYTT
ATNVEAPYTLGKTEKAEFLGMRPYGAVFALEKGDETTTVIVRDVKDSEWEEGDNVKLLLV
DYDFEKNVYFGSTDSALVKNGSKKARKQKNRLSAGAKIENATVIAVGPTEKYVVVSFADP
QDKDLVQFGVVQVADFWCPSQSSSALDLDIGSSIACRLLKPSLSFAKKTPFDDLPLLARE
EEGLLTKTKKKKERAPRAEGETVTLPKYKSEDLVLGKILTGRIAVIKENSMEIKVKTSHT
CGKVVATVSIVDVDEDKDHSHPFDRFSVNMLVGGRILAVLEKGANQRKPVSESNPANFHA
LHLSLRKEDLDAEKSVKELVRADWQENSAGRALLRNGKSIDGVVVEQSEDGLTVKLSHRV
VGYLNALELSNDLDVLREFREKFPVGKRVRCNILNVDEDKNRVDLSIVRLAQLAFKPGSV
VNGLITTKVSAAKPPSIMVCLAGQTFGRVCVTELLPRSQWKNDMHKLPQFAAGKFVKCVV
LSSNGNNIDLSLRQDALDDPAAYIKAPVDEHKVNDLVTAIVVSTTSSGCFLRVGRQTSAR
VMLRDLSDNFIKDPQAEFQPGKLVAGRVVKKSNRGLELSLKASIVSEDVAVLKFKDLKEG
MTVKGTITKVQAYGVFVKIEKSTISGLCHISEIADEKVTQSLDQVFTEGDYVKAKILKIE
DLRVSFGLKPSYFEGEESSSEEEDDDEEEESEDEEEGAEKMEVDEDNDDEEESEDEEEVA
PKAAKRAPPVKVESMDVDEESTSSGDDEPAASAQVGFTWDGFANVLDHKKSNNNDDDSSD
DEDDEEANAASKSSKKKTKQNDEWVALREKALASNDEVPQSADDYERLIAVSPQSSFLWI
QYMAFHVSLTEIDMARDVAIRATSAVSFRDEKEKLNVWVAYMNLEHDFGDEAAFLRVFNS
ALKVNHQKRVYLHLVDLYARAQEDDDVEQTLTTMQKKFRKSKQTWLRALQYQVSQKQFGK
AAETLQKSLKSLEAHKHLPVILKYGQLMYENGELEKARTIFEGILANYPKRMDLWNVYLD
KEIKFGTNVDLVRALFERLIAMDFSAKKMKFLFKKYLQYEQEHGDDDSVEHVKQLAKDFV
AQAAAGK
Download sequence
Identical sequences K3WWJ4
PYU1_T009342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]