SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009405 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009405
Domain Number 1 Region: 73-144
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 8.11e-17
Family Surp module (SWAP domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009405
Sequence length 232
Comment protein Name="PYU1_T009405" Note="Similar to SF3A1: Splicing factor 3 subunit 1 (Homo sapiens)" AED:0.0247796676027482 QI:0|-1|0|1|-1|1|1|0|232
Sequence
MAAPPPADQFQERIARAKEAARLASAAATARSQPPLRPPPAAPFMPPPLGPRAFFPPAHA
HAGPPPPAIFGAPPPPRPPPVGPSAPQMLPPDVQHRIDRLIEFIQRNGDAFEATVREREH
ANPEFAFLRPGAPFHDYFVWKKRQVCGNGGGLPPTPVSMSMPVPSAAVTAEDLLNAMSVG
ALANVCKLTKMNGLPPYAPLSHDHLRNPAVLPPVEPARLEIRIAEFYRDARK
Download sequence
Identical sequences K3WWQ7
PYU1_T009405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]