SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009408 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009408
Domain Number 1 Region: 48-123,155-271
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000000494
Family STAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009408
Sequence length 274
Comment protein Name="PYU1_T009408" Note="Protein of unknown function" AED:0.431908679555738 QI:0|-1|0|1|-1|1|1|0|274
Sequence
MFGLKSLQILALVAAMTAPAVFADVDTNATAAEPVFGELLVNKLTAYPIANRMFAEAETI
WSSKGWYVISNSSGILNEGKPVSGVFAPASVDITRATGVVNAPAQKLFDYLITPIGYQLI
DPASNPDDYYKPPLESYNTFLWRGFGHTDKKRLEAARVEANIPGVKLREFVVLNAIDANT
RLFVSKSVQHKGDPGCSIYGPASCNAISTDPVRALNTFAVQVEPLAGDANKCVVQLINYA
DYIAPEISAAVMKVLTTDYLPQMLGRMQAAFASS
Download sequence
Identical sequences K3WWR0
PYU1_T009408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]