SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009419 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009419
Domain Number 1 Region: 21-312
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000275
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009419
Sequence length 378
Comment protein Name="PYU1_T009419" Note="Similar to crlA: Cyclic AMP receptor-like protein A (Dictyostelium discoideum)" AED:0.108038202831766 QI:0|1|0.33|1|1|1|3|0|378
Sequence
MAAMTPMSTAALPMLSLRFTAETLLVVEQVLLAVSATVSCAGCSFIFATWKSFSAPNYLS
RRIVASLGFAGLVTAFGFSMSIFVNGIGAHYKQTEALCYLQAFTLQYFYLASYLWTACFA
FHLYQIIVKRNEYPEKFLFIYRSIGWGLPGLVLLYLVLRQLTGHLGVGPADRRWCWIAVH
DGEGTGSAADPDTWRREGALQQLLLFYVPIGLVFVFNSAIYYRILRFLSNDPMAGRFKKK
VVLYLVIFFLCSIWGVINRLVQYFGMTHAPSKFLTAMECICDPLQPLLNALAYGTNKKSL
EAYKERFCSSWFYASLPSSDDESGVDTTALLSTDDEREHNEKRFGFDLFSQKRSSNKAKT
KKKRGAYVSNDDFVDSPR
Download sequence
Identical sequences K3WWS1
PYU1_T009419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]