SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009430 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009430
Domain Number 1 Region: 264-304
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.000000531
Family Leucine zipper domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009430
Sequence length 472
Comment protein Name="PYU1_T009430" Note="Similar to SRP40: Suppressor protein SRP40 (Saccharomyces cerevisiae)" AED:0.0274627453330023 QI:0|-1|0|1|-1|1|1|0|472
Sequence
MTAASLAPRRPMNGNGVGGRQTQQANASVPNPAARNVPQTTVSRNLSLPLPPPLPSTARR
FDMSSPPQSGRSALSPSSTISELTASADYSVSAAAASSSQYASNLDMNPLAVATSQKVSK
QTAQKAPQTQQQRAPPQQVKKAHASTRQTFDEAMYFRQGVLEQTGADFQQTLYHQPDNHA
SSKSYAATNAGDLFDGDEDDDDDQLGAASRKRKPATKRKSSKAAAAAALANTYGDDGNLS
NRSEQQGETVKRRCGRKSMNYSSEQKRERNRAAVKKCRQRQALKYDFLVQKAERLESENR
QLTEMLVNNVELEEETRVSLTRGIQMDILFKIKEIFTQSLPKDFVLDADSIWDLNSVLAV
SMPSRCYYGIESIKEFWRTSLRMRNKGKIRSFWAWLFRLQPGDRFSEFDIQPFSPTSNLY
FITWTTKSEPPLSGSMVIMFGQGHRVTLHVECFGWLIWRYLLTNEPFPEPLD
Download sequence
Identical sequences K3WWT2
PYU1_T009430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]