SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009485 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009485
Domain Number 1 Region: 594-790
Classification Level Classification E-value
Superfamily DNase I-like 0.00000000000146
Family DNase I-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009485
Sequence length 1037
Comment protein Name="PYU1_T009485" Note="Protein of unknown function" AED:0.115464340579558 QI:0|0|0|1|0.33|0.25|4|0|1037
Sequence
MKTSAANIEWRKQWRANSSRPQVTIPTDATFAEAERVFLDKDSTAAERKAAALRGVPTPV
NSDQCYPMWIPARDLTSTFSDTEIMTSLGGDQKSTLWANSIVHLRDFKVIRGKGVSFVCT
NREICTKLGNLQLSICGKVFKIQPYSKYSHLYYVELQRLADDTTDSIIYDWFATHGVPPV
YITPSWSANGLQLRNRRVYFNQKDSPAAVMIGGKEPLRQIQFTASGYCVVNHRIQAYNKK
TPPFLLERRKNTSQPSEDPPAAEASSDTPSDAAMQPIIPADTSGDSDADMGSDSDMTSLS
VNPSSMWTSEEQKATIPIPPLPDVCDAYHLIERSKKMIFSTVPVDQAQAFLLPPSQTTYP
LIASHNVYAWITLGSEDASISPDIDVTLHNQDRSPIRSQVTQAEGQIEVQRTTIDYNVES
MSAASLCNYIQAFLRQFDEEPSPEMSIVTVKTQPSLFRPLYDTSNPGNYSVMTGKFYGHA
LLRKISSQELPPELDTFEDKVQAVFNPQDPEDYQTMLSQCLDHNQALFWQQVWIAEFDLL
LQVMAPSIYSDPYKVCAISQAPAQRLQHTLWLLWDDTTLLNLLRSDLMEKLASYSINVNG
FNRVTQSTLNYFSSKFHIIALQETKFTNPANLKRADFLWKKSSSFNTAFWSHDHSNMYTG
QAGVGILLTPTCPVQDIQDITETQVSDRNTLSRYLVLQGALDGSPAYIHAVYAPVNPTDR
PSFFDSLPRQFEENAIHMALGDFNTVFSTQLDQAQTNNRARREGRQELLEWMQALNLFDA
WRLQNPMFANLRVPTEVLLKQLKHDWKHQPNKADHCGIEFTLGSELFKPRTRAPWRCPSW
VIELPEAQEYLKLSLIKLAESIDPTITSTYNPGYLLDEHKRQDCIYLRQLFNEKKNKRQV
EKEDLHMRINQLQHLQHLSPSQEVSTTLSSLQQKLRVHIEEEDHHKSKQKFASDLYQSEK
CTNFADDCTGLLTDLSLAPEFLQRVQDFCSAAGMKLNTHKTVILPFREWTGEDEELQTQL
QQLGVQVIDNTGEAKLL
Download sequence
Identical sequences K3WWY7
PYU1_T009485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]