SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009494 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009494
Domain Number - Region: 157-197
Classification Level Classification E-value
Superfamily EF-hand 0.000138
Family Parvalbumin 0.076
Further Details:      
 
Domain Number - Region: 48-129
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 0.0461
Family beta-Lactamase/D-ala carboxypeptidase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009494
Sequence length 217
Comment protein Name="PYU1_T009494" Note="Similar to FUNDC1: FUN14 domain-containing protein 1 (Homo sapiens)" AED:0.203419374171732 QI:0|0.8|0.66|0.83|1|1|6|89|217
Sequence
MSIQRSQMLLMRPQIVKLSVRNSAASSGKKMHTQALALRLPSRSMAAGNKTTNIAITGAA
LAAGVIALANEAALSQEALFNIIDGKSGSGNGGNGKKDNEYVDWIIDQVAGRIGDITLGG
GLGFCSGYALKQVGKVAAITIGGLFLLAQIASSKGYININWKKVEKDVITAVDPDGDGKI
TKNDFKIWLNQLLSMLKHNLPSSAGFTGGFVLGLSCS
Download sequence
Identical sequences K3WWZ6
PYU1_T009494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]