SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009503 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009503
Domain Number 1 Region: 575-649
Classification Level Classification E-value
Superfamily Homeodomain-like 5.08e-26
Family Myb/SANT domain 0.0045
Further Details:      
 
Domain Number 2 Region: 499-566
Classification Level Classification E-value
Superfamily Homeodomain-like 8.33e-18
Family Myb/SANT domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009503
Sequence length 678
Comment protein Name="PYU1_T009503" Note="Similar to MYB: Myb proto-oncogene protein (Gallus gallus)" AED:0.0891016200294551 QI:0|0|0|0.33|1|1|3|0|678
Sequence
MTAQATSTSVPKKRKNDEMTDDAAMPPASPRGVQCSLCSFTAVDLAQSLTHLKEHHHSDK
DSNSVSGSMDQALQVGQLLLAHHALASPQDPVSPPSGSSATSAAATSTTAALLADTRRQY
ARILTFFQSLQQQNARAATESLRQLFQDNLSLMSTLQDASTQALERAQQTAAQQQNKNLD
ASQRESGDADMAQDDGEETESETGRASIHEEEAAQALTGLRQLTPRVASAAAADHEKKLQ
SMNAAQAFAAQLSAGAGPMPPTQSQRPPIHHHSDLKSPRTFPGFQQQPQPMHASFGGNAR
SPLSITAPPPQSSLPGMTSPIFHQPVSTPSGSLPSLFSRPLLAPLSSPVPQHHHHPHSLH
HAENGLYGQHQMLPTPTGMLNGAKQLAPPAVDWKSVATSESQPPHSSMNNSVNGASSSTL
NPKLEPSPTSVTPVTTGYYRQQHFHQTTGGGHTSPVKRKSITSKQLMATPHTGPLGLPPS
TAYAIIERNNHPVRKANPRRWTKEEDEALRHAVESHREKNWKAIAAEVPGRNHTQCLQRW
TKVLAPGLVKGHWSPQEDDLLRRLVASEQKNWGEVAAKIPGRTSKQCRERWHNHLDPSIV
RGAYTPEEDRIILEAQARLGNRWSVIAAMLPGRTEDAVKIRWKSHCRVWRARKYLRKSPS
DHPGGTGRDRGRQGRRRQ
Download sequence
Identical sequences K3WX05
PYU1_T009503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]