SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009522 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009522
Domain Number 1 Region: 38-208
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000187
Family PLC-like (P variant) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009522
Sequence length 349
Comment protein Name="PYU1_T009522" Note="Protein of unknown function" AED:0.388541076487252 QI:0|-1|0|1|-1|1|1|0|349
Sequence
MAARTTTTSIVAATPANRAHLESFQFEKHVTHQDGMAGTLSIRLVEARNLRAASSMFFVR
TCNPYVIFRIGKMNVRSSTIVANDNPSWGRREKLEMKIPKLDHKRSPLDDHSDIRMELIV
DAMNEDSLTGKTTEYVGMQNGSVIGTAVVDFTALLEGKEEVMDRWITLTGGIPVVNPSDN
VTSGKKPKRAPEKAMDLGEVRIILHYEPHGMEPQVGDVVKLEGFGAYPSALLAPVDELEL
HVKKISGNYLLCSYLTKSGFEGAMRLHRNNVFVAHRNSLLDRLYVSCIAEPFEFVRNTPI
GQSAGEVLKPYMNVARTFSFPALKAAKATVITTFRASTAALGAVVASME
Download sequence
Identical sequences K3WX24
PYU1_T009522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]