SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009546 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009546
Domain Number - Region: 114-180
Classification Level Classification E-value
Superfamily PH domain-like 0.000101
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009546
Sequence length 224
Comment protein Name="PYU1_T009546" Note="Protein of unknown function" AED:1 QI:0|0|0|0|1|1|5|0|224
Sequence
MSEVVVYTTIAAVYSKNNSSSSSSNVKPQMDEHVMQVSEAGRTSAAVSSASTINIASGGL
PQRALRSSPLEPSMKWTPIADGAWAQIHLFLEMESELNSAKKQKKTSKQTKGVLKKFRIV
AWILDTGKVIVNDIVRKGCKWEQVSGGNFRKFTGITGQVYGFGFRNALQAAECSHFINQI
LSNTKAIKRFVKKLFCIQLSTRDYLSLLPDMGLNCMRGNYIQEH
Download sequence
Identical sequences K3WX48
PYU1_T009546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]