SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009589 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009589
Domain Number 1 Region: 87-304
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.25e-59
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 418-731
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-39
Family Extended AAA-ATPase domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009589
Sequence length 991
Comment protein Name="PYU1_T009589" Note="Similar to mcm6: DNA replication licensing factor mcm6 (Dictyostelium discoideum)" AED:0.155241935483871 QI:0|0|0|0.5|1|1|2|0|991
Sequence
MMNAGGGGMAAGAAGTGNKRGRNGNPANRSAASLNPTGAPVELQVDTTAEAVKVRFLQFL
CGYGQQQPEDADMQDDTESQTMRPPTVNYSHQAEVMRNTETSSLFVDFTHVLEFDPDLAH
AIQAQYYRWEPYLRTSVFEFIRMEDAAYTINEDANKTQREFFVCFYNFQHVSHIRDLRTR
SIGELVSFSGTVTRTSEVRPELLFGAFTCGECGGDTTGVEQQFKYTEPVKCQNPFCPNTF
MWELNTEKSVFVDWQRVKVQENSDEIPPGSMPRSIDVILRHENVEQAKAGDRVVFTGTLI
VVPDVSKFVKAGGETAIATRGNRGGENSTQGMEGEGVRGLKALGVRELTYKTCFLACSVQ
TMEQRFNSISIRSEFGDEESGESGADAAQEFSEEELHAIQRMKQDPDRYIKMAKSICPSV
YGHDEIRKGILLMLFGGVHKTTLEGIKLRGDINVCIVGDPSTAKSQFLKYICGFLPRAIY
ASGKVSSAAGLTASVTRDADSGDFCVEAGALMLADNGICCIDEFDKMDPMDQVAIHEAME
QQTISITKAGIQATLNARTSILAAANPYNGRYDKTKTLKYNVNISAPIMSRFDLFFVILD
DCDEIIDMKIAEHIVNIHMPSELQAPLNSTGAYSEEDLKRYIKFARTLNPVITPESKRMM
VACYRSLRENDVVSNGQTNIAYRITVRQLESMIRLSEALARLDLSEVVLVSHVQEAYRLL
SKSIIHVDMQNVELALPVIPQEDGEDDDDNDGDNGGSLGSGKAATAVSGQSQANGDEKSS
SRGSAEKQAADTSASASTSKAGDQSITFERYATIQKAVARYIREKEEEALTAKLARKAAA
QAGGDGEGDAVQEDDDDDDDDAGVMQGELVTWYLASQDITSEAQLSREKKMICSVLDRLI
QDKILSVIAMEDDDDAFGGQEDDEEAEQEKDADRGDDGDVKMDDDEDEAKDPSFRSTTAQ
RRKAKKKLTPEQLEAANQERYLTVHPNYALE
Download sequence
Identical sequences K3WX91
PYU1_T009589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]