SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009610 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009610
Domain Number 1 Region: 129-173
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000211
Family Leucine zipper domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009610
Sequence length 457
Comment protein Name="PYU1_T009610" Note="Similar to INCENP: Inner centromere protein (Gallus gallus)" AED:0.203596095965483 QI:0|0.33|0.25|0.75|1|1|4|0|457
Sequence
MEAARYCDAALMETPFDSDEDVIMPLYEDTLEPSTLRANAIDNDGENEDGSRTRSASESM
NSPCSENGIRVNMEISPTRWIKAKTKKDKPKQAKKKASAATRRTATQDGEHEQAEDDAVA
RRKQASIDQRRKRNREAMQRARQRDKDYMDGLRDTAHALEEKHNELLEKVNAQLAVFTNS
GHSNSRIAELQDRLQQARNHAEALKRQNLEFLDKIGDRIKREDRMEGLLRELMREQEAQE
EMLNEIFRESITETQLGVFFTEERAMRVIINSRNDKSQVERQGFDNAPVGDLFGWSTQYR
FEGKIFYFSFVKTFRNRRAVDTIQKINDETYLIARENRDPEKADEFVRLLYLRFRLHEDD
GSYAVVTQSVRQEQSLYEGLDCIWANEACMWTQFTPMVERYGDEIFEACQVKMIGKSTIG
DERSARENVLETILGLMRWENINVGPMLSLTNSTTQC
Download sequence
Identical sequences K3WXB2
PYU1_T009610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]