SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009611 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009611
Domain Number - Region: 191-317
Classification Level Classification E-value
Superfamily Bet v1-like 0.0302
Family STAR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009611
Sequence length 350
Comment protein Name="PYU1_T009611" Note="Protein of unknown function" AED:0.218068476918034 QI:0|0|0|1|1|1|2|0|350
Sequence
MLKLRETVERLEVRYQRELNQREQTKTASASSDPKATMFPYMTSYTQNISSIGAGPHSKY
SELISASSRLKEENFHLKQLIHEKQKLQETLERNFGDFIQSSPSSPTSLRDTIEKMSVTD
LVDDDYYVPMTTEECWIRIRDTHVHMNAIHQSLTRRTALNDRRQPNYFGWKIQHHFHDQV
LLFLFEKPFYHISAFQVMEQMWANELAMQSYRPEAEAARQSMRVLQHMNEDTYIFQRRML
DPATNTYTKSSYMRFRARTANGYMIGFRTVNPGDFSNGKPKTWASTACIRTEFIQQCSPF
GQEYCVVRMIGDTNLQGDTEHDHRVAANTIIGLLQWENKNIGPVFTLTGN
Download sequence
Identical sequences K3WXB3
PYU1_T009611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]