SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009614 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009614
Domain Number - Region: 39-85
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00169
Family Leucine zipper domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009614
Sequence length 403
Comment protein Name="PYU1_T009614" Note="Similar to OBF1: Ocs element-binding factor 1 (Zea mays)" AED:0.397337908241852 QI:0|0|0|1|1|1|2|0|403
Sequence
MDAPPLSATRDASSASFHHRLAPAAQTNALSVSKLSAIELRRKRNRESMQRTRVRERAEI
DKMRAELRMLEKQQCQLAATVAKLATLTARQSKDIKRENFGLRQTLERRRKSYERVERIL
ADYHLEKTDIAWDDGDSDDAVATTFASTSLTSSASASSVFGFEPITEDQAFALITQCSAS
VRRLEKAQQQAAAPPHSIYHSMDLETRCFGWRVQRKVIGGSNLQFLFTKTYPNLDPALVA
CKAWDIYRTSDQNSMKSIRVLRFETLQVVNENTHVVAREILHPLHKRVVMRTIFLRFRMQ
TDAGFVVGRSCMNPHPGSPQRPSEMDESVGPMSSGVRYADITTWLEVNYVNPDDKTQIGC
EVKLGGFADYGTTNDLNNRFMNVLFSILRFENRVLEPLVPLLQ
Download sequence
Identical sequences K3WXB6
PYU1_T009614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]