SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009615 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009615
Domain Number 1 Region: 74-164
Classification Level Classification E-value
Superfamily Homeodomain-like 1.43e-19
Family SWIRM domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009615
Sequence length 187
Comment protein Name="PYU1_T009615" Note="Similar to Smarcc2: SWI/SNF complex subunit SMARCC2 (Mus musculus)" AED:1 QI:0|0|0|0|0|0|2|0|187
Sequence
MSTSPASAAPAAAPAATSASPAPTAASASPTAEAIVPAPPASLSPTPSHASSPPQELSAR
QGDAPSQDPVEKSVVVPRCSTWFSMDAINPIEKRMLPEFFVNEALYRNFPPGAKSNASKT
PQIYLKYRNFMINAYRQQPQVYLTATACRRNLAGDACAILRVHELGFMSRFHRHYRESVS
VLGRAVA
Download sequence
Identical sequences K3WXB7
PYU1_T009615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]