SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009616 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009616
Domain Number - Region: 154-193
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0063
Family Leucine zipper domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009616
Sequence length 516
Comment protein Name="PYU1_T009616" Note="Similar to Hgs: Hepatocyte growth factor-regulated tyrosine kinase substrate (Rattus norvegicus)" AED:0.270201870121637 QI:0|0.5|0|0.66|1|1|3|0|516
Sequence
MADAAHTPPTAVSMALPQSAGGTRSVPDSVDAVLDDELLLNHWIVDICEQLGADDDTADA
AVKPFEAHAGPIAPIYAPQIDSNLSSTASSPSSDSSATASAYAEATDTRPLIKPLPHAVG
SRRRVAKKPVASRRSSPDEHQEELLLGAGDASAETRREKNRLRVRRHYYRKLTQMNELRT
QVSALEDKIRELQLSNASASSGAHGSVVVKKASFRQQQQLEQYLRELETAKTSLLQENQH
VRSILHEQAQQFMAIRNRLIDEFKYLPSPFPMPFIVKRKLAPAECDRIWQTTKHGLRDVL
RHTQGLVSVDNISGDGGAVCGWHTTRVVEDGSFKFVFQKMLYNRTAEKMRDAAWRVLSDP
AGFTKLYPPSVKMWISLVQTVDNDNVVLFQEHRSMDKDNVLAFMKTILLASRVTMQKTHG
DGANLDEFSITLRGLEHEQLMLEDLVVSCHEVWNDINTWLQWIPRGEHGEHCELKVSGAI
PTVGSNSYFWVVEVLLIVMRLEAATTAEQLLEVPCE
Download sequence
Identical sequences K3WXB8
PYU1_T009616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]