SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009623 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009623
Domain Number - Region: 169-208
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0105
Family Leucine zipper domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009623
Sequence length 566
Comment protein Name="PYU1_T009623" Note="Similar to DDB_G0274435: Putative uncharacterized protein DDB_G0274435 (Dictyostelium discoideum)" AED:0.189110009922475 QI:0|0|0|0.5|1|1|2|0|566
Sequence
MSAWGLHQQQQQQQLHGRVDGAVELQPTPEPLYPQYSDEVPAAQQFGAVYGFAYEPQPPL
SPQGDDQAAFFPLDEPVVANKYDVLGTAPPLELMDLTEAPYGNRMDPLLIRTEPFSLEPE
SYAVVTPPSGDGSPVSFSASMATPRTSEDDDHGDDDDDAVADKKALLLQQRRKRNREAMQ
RARRKEKELLTSLRTTLRELDAQYKALTKWEVQATSPQQAAECQRLQKQLAAVIQRRREL
EAENAVVIHALDDQKRRLRDLERVLAECRLEDAQNDFAAAAEKLALLEAQEAQYSSQGTK
ADWTTSNYEYGFVPLSNEEVNALLSTFCNNLQTAKEHALVAPSHEPFFDVLGWQSHRHID
ADNQMHFEFIKCFHHLSTREMAERAWSDGVDLEQYSGKRKSPNPNIRCMEFLQQVNERVR
IIVREMKHPVENTIFRTHYALFMLETREGYLLGIQSINPSTEQQEQLKQQRQEQDQQQPS
EATESVVWADVCIYIEFVRRPHAFAGTNVSDDGIEGFRQDDCEVHWRGRTNYKTPKHAAE
NALSFLMGILKWENQIAGPRFHLTAS
Download sequence
Identical sequences K3WXC5
PYU1_T009623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]