SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009635 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009635
Domain Number 1 Region: 75-116
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0000588
Family Leucine zipper domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009635
Sequence length 474
Comment protein Name="PYU1_T009635" Note="Similar to CCDC23: Coiled-coil domain-containing protein 23 (Taeniopygia guttata)" AED:0.16 QI:0|-1|0|1|-1|1|1|0|474
Sequence
MATQQEQQINDSSPSGIEDTKFIVADPTEAGSPHDRKQQQKNETTQQPSRWLQWESSNEL
FLDCADLPNASALEIRRRKNRDSMRRSRQRQRDELDQMKGMVAQLEQQYETLCMRTGASG
DDATTTSANSAREAAYLDAIDLVKRLGAENLYLKASIQEQASWKLQLHRVLESNGVGLGN
SCSSSSNSAEIDVFMHEHKDNNNANALTQEEMKAIFGFMALCDHDVKDVILDSTKQVQGV
QNRLLDDLVNQQYVSSPRDRLSVLGWDVRRRMDGHEMEFAFVKRFPNVSAYSVMKKTWDA
DLKLDRFKKIKSETRRLDILQQVSANTYVLGRDVCFPDDNLVFRTVYLRFRMETSSELPP
YTAVQSGSQPLCKNGYVIGTQSINPGAGEDGDKEFQPSLPCIEDHEKLVWADMTLWMEFF
DVCDPGSGHNVCEVRWTGKTNYKSERHAYRSAADTLMGLLRWEALAIKPVVSIR
Download sequence
Identical sequences K3WXD7
PYU1_T009635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]