SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009640 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009640
Domain Number 1 Region: 52-248
Classification Level Classification E-value
Superfamily Bet v1-like 0.000022
Family STAR domain 0.03
Further Details:      
 
Domain Number 2 Region: 279-340
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000576
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.024
Further Details:      
 
Weak hits

Sequence:  PYU1_T009640
Domain Number - Region: 390-433
Classification Level Classification E-value
Superfamily ARM repeat 0.000112
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009640
Sequence length 551
Comment protein Name="PYU1_T009640" Note="Similar to Ythdc1: YTH domain-containing protein 1 (Rattus norvegicus)" AED:0.373732018949572 QI:0|-1|0|1|-1|1|1|0|551
Sequence
MVFRPNFPLPKDYFAAARVSDEQETRYRGIVDARLASALRDEHDFAHSWQRVVDADKWRL
VKKKHQLRVYRRRKYTLTSDEDKRKPSMLSVGRMTGCLEDVIYGAYDKSTEELKTTIAFV
DLATKDCRVLHNIALATPDDPFHYIGIKWLYTELPAKFIVRPRDWCYLEAMGIQVDANGN
RFGYILQHSIDINNCVPFDRRAVVRGRLRLSFIFREPIPGMLEVFAQGLFDPAGELIQRF
TTIVTSEVISGIFNTVPCAEAKKLTLLALRNFKDKTRPGQKTLELCFMCRGTGKTLFSSS
LKVCRVCSVTVCSQCRVKKSVFIGPAHSISKVSCCRTCIAHAKAMEIHPSDPNFSILGEQ
FLSQDPFWVQSGGFNSVESMEETTVFSDNNGKEDTEQEEEEEEEEEEEEEEEEDEEEEED
TYNDTDDLSDLDTDGYRFSAGSGVSENDVEKMIATLMEKKRTERISAQYGKLDFETHVKA
KNAPSEERFQNQAEAGHDEDHASHIPTSPSGVGNLSPDQAAILQKILALQIAAEEVSSTL
HANDAILKSFT
Download sequence
Identical sequences K3WXE2
PYU1_T009640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]