SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009641 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009641
Domain Number 1 Region: 324-392
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000115
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.015
Further Details:      
 
Weak hits

Sequence:  PYU1_T009641
Domain Number - Region: 193-285
Classification Level Classification E-value
Superfamily Bet v1-like 0.000549
Family STAR domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009641
Sequence length 404
Comment protein Name="PYU1_T009641" Note="Similar to fab1: Putative FYVE finger-containing phosphoinositide kinase fab1 (Drosophila melanogaster)" AED:0.579080702626564 QI:0|0|0|0.33|1|1|3|0|404
Sequence
MRSSTSLPFGAVSKELATRLEAEAEGLVQHHVRAYEAHLYYQNRQELRDPRVWRRVQSNG
KQGFSVYRRVRRRRDQSSAGNTTKTGLALSRLNGPAPGPQGCSNSSNSSGASAALSALSS
SALPTQLLGIGFTIGTIEDMIFGSVANTTAAIKIQSLYVNDPIVDAAVLAVLMPPNGNDP
LRSVTLKWILKKPKMYGVTRHRDYVFVESIGIRRSVSGERIGYHLMHSVELPSFPPLSAD
DAVVRRRFSSCYLYRSIGSGLIECFLRSSTDPWRSTPEPLVIHAAANRLLQCCPGFMRVA
ETNKLIFALQHEMRNAKDRPARRHEDPTSCHSCLKNFHMCKRGHPCQLCEQICCSRCLIV
WKTSFAFSLLSEASVLEKRLRFCRSCMISAQAANPLHIAATRLC
Download sequence
Identical sequences K3WXE3
PYU1_T009641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]