SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009653 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009653
Domain Number - Region: 77-121
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.000119
Family Leucine zipper domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009653
Sequence length 405
Comment protein Name="PYU1_T009653" Note="Similar to PRPH: Peripherin (Homo sapiens)" AED:0.0923645320197044 QI:0|0|0|0.5|1|1|2|0|405
Sequence
MATTFSEGFFVNLFNSEELMGLWDGVNSGEVGEEFHESKIVADEMSTTDYRNDSLSGQCS
SPGAHTKKRRTYTPAQRIMRRKRNRDSMRRVRQRKQVEFAILRKKIELLEAKLQELHALR
SDHMSSLVLCSSDVKKACIPVRQPRSNVNVEAILEEIKRLQSEQVCLTNAILSHQEVSAT
LAQIMDESTDTLGAYSETVSENPSNWIMNLDATSQDFQWVHDVLPLLPTISRAHVQELIR
ESYLDILDRVDYADSGDKRSADPAFGWSDRRSVEGNWADFCFGKDFEHEHMDALVAKTWS
ILTSADYQQQHHDDFHSKKLQIKILEQLSEDAYLVARNSLFPVDGHYYSSIYVLFRVKTA
HGYLIGGRTICTPPGNSLVIDGCLDANRSYLHMYCAMIFSQPSSK
Download sequence
Identical sequences K3WXF5
PYU1_T009653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]