SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009656 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T009656
Domain Number - Region: 93-136
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0169
Family Leucine zipper domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009656
Sequence length 472
Comment protein Name="PYU1_T009656" Note="Similar to recN: DNA repair protein recN (Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395))" AED:0.322677527670688 QI:0|0|0|0.5|1|1|2|0|472
Sequence
MKVSFQTNGFRAPGGVAPPPGVNDAADDRLLDELLSIFMVPDDFGRQVDISYDSSSSGDQ
GDASSTYSNSTVRITTTSPSLDAMAKERRSLEMRRKRNRESMYRLRQRKKLADSKLQELA
KGLEMRLQRLKIRQQQQGQRPWPPSALARAGIDLLNAPTNALELLSQGNDGGLNYRQMME
EMLVELQQVEQKMRSENAHLAQEIYKHEQAFHALREVIAELREAERLTPVPQEYDPVAWV
NEISHYMPHLYSSDVFQLMATSMQEVLGTLTTVNKMPESKYDIFGWRVKREINNTWIDFM
FSKDFVHMDIDTVARKTWAVQSHATDVQETMGRMHFMKVLRAVNDHTLLCARNLFFPNDY
TNYIMIYVLMLVKTSQGWIIAQRSLMPEDGVNVQAILGPNFSYVNAFYGMVLTRLKTTNT
DGSKTISPTGCNATYGGRMGDGTKHYTDVVGPENFFAMLRWESACVGPLLGR
Download sequence
Identical sequences K3WXF8
PYU1_T009656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]