SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009657 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009657
Domain Number 1 Region: 347-415
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000863
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.029
Further Details:      
 
Domain Number 2 Region: 44-72,109-277
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000595
Family STAR domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009657
Sequence length 433
Comment protein Name="PYU1_T009657" Note="Similar to SRP40: Suppressor protein SRP40 (Saccharomyces cerevisiae)" AED:0.508715547694042 QI:0|1|0|1|1|1|2|0|433
Sequence
MGSRAIPVNAVPRPELSRDEQHEFKALANESVHETLLAYEDFLYVHKRRVDKTRWKLVKE
KEDVHVYRERGNSAASSSSSSSSSSSSSSQERARRKTLEIGPKAAMAANSAIPLFLVNGT
VQGTIDDALYGSYADDPTSMRRRSIYMQDLMEDQAILSTLEGPTMEDPFNHLSLVWMLRD
FPGLGAVVKNRDFLILSKTGTTTTSRGERIGYCLMHSVQHPDLPQFDAASVVRAKTSFCL
LFRQIEADRLDVFNQVATHVGGHMMNFLVLQEVAATLLTCGKAMNSANKKKLFYFMRKQA
RALSASTLGGGARGPPSSPGSNSSHSSSNTTASTKALVARFQNTDKQISDSCASCSKSFG
SRLFSPSGTWCQLCQKMVCSRCVVKKKIVIEASEKKVITKPFEFCIVCTFTVKNASARQI
HIDELQQRYAHLT
Download sequence
Identical sequences K3WXF9
PYU1_T009657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]