SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009662 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009662
Domain Number 1 Region: 204-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000278
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.034
Further Details:      
 
Domain Number 2 Region: 74-160
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000426
Family STAR domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009662
Sequence length 459
Comment protein Name="PYU1_T009662" Note="Similar to fab1: Phosphatidylinositol-4-phosphate 5-kinase fab1 (Schizosaccharomyces pombe)" AED:0.171739130434783 QI:0|-1|0|1|-1|1|1|0|459
Sequence
MPQLLAVGTVVGTMEDMIYGMASPSRAQAIMKDFYTQAEIVDTRILYEIKGPTPEDPLRF
LGLKWLAKGHTSGMGTLVRPRDLVYLENTGIKTRADGTRIGYIIMHSVDIDECRDLEAER
EIVRGRISSCYLFQQLPNGVVSVYLKSCVDPSGNIAESIAVATTAKSLIGFGRATICAHH
KKIAWELHKKRYHITGGASPTHEATTSTRSRSFNSTACNVCEKSFSNFRAACSCQLCGVL
ICSKCRTERKLVVVTLHGSSRNQVVDDESVDLCRSCIARCTRIRAEDVAREEILSGYYGS
IPKPKEPAKRDHHAVSVYETVSSTMSADGLSDLVDQLASFRTQETSPPFTLESDYINDDE
DGEKVTELNHDSIQKTYSNASDTSSDSHSPPQASSLPAYAEHDLYQRIAQLNQTAESVYQ
YTKQTGVLVSSGVFASTRLPNQRAPAQMASTVVVEDELD
Download sequence
Identical sequences K3WXG4
PYU1_T009662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]