SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T009664 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T009664
Domain Number 1 Region: 326-399
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000446
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.034
Further Details:      
 
Domain Number 2 Region: 196-282
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000604
Family STAR domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T009664
Sequence length 581
Comment protein Name="PYU1_T009664" Note="Similar to fab1: Phosphatidylinositol-4-phosphate 5-kinase fab1 (Schizosaccharomyces pombe)" AED:0.14467271345493 QI:0|-1|0|1|-1|1|1|0|581
Sequence
MKFPLPADVFPDVDLSRERRAAFTRLARAVLDDALEGCALYNRANRQLNKTQWKPIKSRE
NVTVHKEKRGSHASPSPAAVGGHIVLSSSRSDSRSQSSDVSSTTSSLGLVAGSVNAGLSD
CTMPQLLAVGTVVGTMEDMIYGMASPSRAQAIMKDFYTQAEIVDTRILYEIKGPTPEDPL
RFLGLKWLAKGHTSGMGTLVRPRDLVYLENTGIKTRADGTRIGYIIMHSVDIDECRDLEA
EREIVRGRISSCYLFQQLPNGVVSVYLKSCVDPSGNIAESIAVATTAKSLIGFGRATICA
HHKKIAWELHKKRYHITGGASPTHEATTSTRSRSFNSTACNVCEKSFSNFRAACSCQLCG
VLICSKCRTERKLVVVTLHGSSRNQVVDDESVDLCRSCIARCTRIRAEDVAREEILSGYY
GSIPKPKEPAKRDHHAVSVYETVSSTMSADGLSDLVDQLASFRTQETSPPFTLESDYIND
DEDGEKVTELNHDSIQKTYSNASDTSSDSHSPPQASSLPAYAEHDLYQRIAQLNQTAESV
YQYTKQTGVLVSSGVFASTRLPNQRAPAQMASTVVVEDELD
Download sequence
Identical sequences K3WXG6
PYU1_T009664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]